liraglutide-notes.peptides3081.com › Topic › Stability Storage And Analytical Testing — Complete Guide

Stability Storage And Analytical Testing — Complete Guide

By Editorial Desk · published 2025-07-15 · last reviewed 2025-09-02 · Topic

A practical reference on HPLC assay: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.

Reviewed 2025-09-02. Anything still debated is marked as such rather than presented as settled.

Stability Storage and Analytical Testing

Quality assessment of creatine monohydrate typically uses high-performance liquid chromatography to separate creatine from creatinine and other impurities. Other methods include nuclear magnetic resonance spectroscopy, titration, and infrared spectroscopy for identity confirmation. Purity is often reported as a percentage of the labeled compound on a dry basis, while moisture content is measured separately. Because different analytical methods have different selectivity, comparing purity values across sources requires attention to the method and sample preparation.

In dry solid form, creatine monohydrate is relatively stable when protected from moisture and heat. The crystal lattice includes water, and exposure to high humidity can cause caking or gradual changes in powder flow. Elevated temperatures may accelerate decomposition, particularly if moisture is present. Studies generally report that sealed, dry material retains acceptable purity for extended periods, although exact shelf life depends on packaging and storage conditions. Light exposure is not usually considered a major factor for this compound.

In aqueous solution, creatine monohydrate undergoes a slow conversion to creatinine, a cyclized degradation product. This reaction is pH- and temperature-dependent, and it proceeds faster in warm or alkaline conditions. Because the conversion is gradual, analytical measurements of creatine in solution must account for time and storage history. The equilibrium favors creatinine more strongly at higher temperatures, which is relevant to sample handling in laboratories and to beverage formulations. Refrigeration slows but does not entirely stop this process.

Chemical Identity and Background

In the body, creatine is synthesized from arginine, glycine, and methionine, mainly in the liver and kidneys, and is also obtained from foods such as meat and fish. About 95% of body creatine is stored in skeletal muscle, where a fraction is phosphorylated to phosphocreatine. Phosphocreatine serves as a rapid reserve of high-energy phosphate for short bursts of ATP regeneration. The monohydrate form supplies creatine after dissolution and absorption, but it is not itself the active phosphorylated species.

Creatine was first identified in skeletal muscle extracts in the nineteenth century, and its role in phosphagen energy buffering was clarified in the twentieth century. The monohydrate salt became widely studied after methods for inexpensive synthesis and crystallization were developed. Modern research examines its effects on muscle energetics, recovery, and cognitive performance under specific conditions. Findings vary with population, exercise protocol, baseline creatine status, and measurement method. Studies often compare supplementation with placebo during controlled training or testing schedules.

Creatine monohydrate is a hydrated form of creatine, a nitrogen-containing compound involved in cellular energy metabolism. Its molecular formula is C4H9N3O2·H2O, with a molar mass around 149.15 g/mol. The monohydrate is the most common solid form used in research and commercial settings because it crystallizes readily and remains stable under ordinary conditions. The term monohydrate indicates one water molecule per creatine molecule in the crystal lattice. It appears as a white crystalline powder with low odor.

Creatine-monohydrate at a glance

PropertyValueNotes
Typical storage temperature15–25 °CCool, dry, sealed container; avoid heat
Relative humidityLow; keep below about 60%Moisture promotes caking and degradation
Primary degradation productCreatinineForms by cyclization, especially in solution
Common assay methodHPLC with UV or RI detectionSeparates creatine from creatinine and related impurities
Moisture contentTypically reported as percentageMeasured by Karl Fischer titration or loss on drying

Background from the literature

Sensory evoked potentials (SEP) are recorded from the central nervous system following stimulation of sense organs, for example, visual evoked potentials elicited by a flashing light or changing pattern on a monitor, auditory evoked potentials by a click or tone stimulus presented through earphones), or tactile or somatosensory evoked potential (SSEP) elicited by tactile or electrical stimulation of a sensory or mixed nerve in the periphery. Sensory evoked potentials have been widely used in clinical diagnostic medicine since the 1970s, and also in intraoperative neurophysiology monitoring (IONM), also known as surgical neurophysiology. There are three kinds of evoked potentials in widespread clinical use: auditory evoked potentials, usually recorded from the scalp but originating at brainstem level; visual evoked potentials, and somatosensory evoked potentials, which are elicited by electrical stimulation of peripheral nerve. Examples of SEP usage include:

ASBMB hosts and sponsors numerous meetings each year. The annual meeting is held each April in conjunction with the Experimental Biology meeting. Additionally, themed special symposia are organized throughout the year. The society also produces webinars throughout the year focused on topics related to scientific research, professional development and education. The society offers twenty-five different awards, grants, and scholarships.

Negative mass selection, which is removal of plants/seeds with unwanted properties, can be done when preparing seed for planting, at field visits during the growing season and at harvest. Removing unhealthy/deceased plants from the field is a simple way to improve the population. Before planting it is normal procedure to clean the seed to remove seeds from weeds and this will also remove small seeds, introducing a weak selection towards bigger kernels. Seed can also be sorted according to color or protein content.

A throat culture may be done to investigate the cause of a sore throat. Most sore throats are caused by viral infections. However, in some cases the cause of a sore throat may be unclear and a throat culture can be used to determine if the infection is bacterial. Identifying the responsible organism can guide treatment. The person receiving the throat culture is asked to tilt his or her head back and open his or her mouth. The health professional will press the tongue down with a tongue depressor and examine the mouth and throat. A clean swab will be rubbed over the back of the throat, around the tonsils, and over any red areas or sores to collect a sample. The sample may also be collected using a throat washout. For this test, the patient will gargle a small amount of salt water and then spit the fluid into a clean cup. This method gives a larger sample than a throat swab and may make the culture more reliable. A culture for Streptococcus pyogenes can take 18–24 hours when grown at 37 degrees Celsius (body temperature).

Sources: en.wikipedia.org

Related pages on this site

Reference notes

Carnitine is an essential cofactor for mitochondrial transport of long‑chain fatty acids (a major lipid class) into the matrix for β‑oxidation. gamma-aminobutyric acid is a neurotransmitter. 5-HTP (5-hydroxytryptophan) is used for experimental treatment of depression. L-DOPA (L-dihydroxyphenylalanine) for Parkinson's treatment, Eflornithine inhibits ornithine decarboxylase and used in the treatment of sleeping sickness. Canavanine, an analogue of arginine found in many legumes is an antifeedant, protecting the plant from predators. Mimosine found in some legumes, is another possible antifeedant. This compound is an analogue of tyrosine and can poison animals that graze on these plants. However, not all of the functions of other abundant nonstandard amino acids are known.

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

From the 17th century, and before modern developments in organic chemistry nomenclature, acetone was given many different names. They included "spirit of Saturn", which was given when it was thought to be a compound of lead and, later, "pyro-acetic spirit" and "pyro-acetic ester". Prior to the name "acetone" being coined by French chemists, it was named "mesit" (from the Greek μεσίτης, meaning mediator) by Carl Reichenbach, who also said that methyl alcohol consisted of mesit and ethyl alcohol. Names derived from mesit include mesitylene and mesityl oxide which were first synthesised from acetone. In 1839, the name "acetone" began to be used, because it was obtained from acetic acid. Unlike many compounds with the acet- prefix which have a 2-carbon chain, acetone has a 3-carbon chain. That has caused confusion because there can not be a ketone with 2 carbons. The prefix refers to acetone's relation to vinegar (acetum in Latin, also the source of the words "acid" and "acetic"), rather than its chemical structure.

Sources: en.wikipedia.org

Notes from published material

In the first decade of the 21st century, what was called "age management medicine" was considered a field of alternative medicine, and, as of 2007, was not recognized by the American Medical Association. Other names at this time included "antiaging medicine" and "regenerative medicine". Age management medicine is controversial. The field is underregulated and supported by insufficient scientific evidence. People who practice it open themselves up to legal liability on grounds of negligence–malpractice, warranty issues, and product liability. The use of growth hormone has been frequently recommended; however, such use is associated with cancer. Age management medicine is often promoted by anti-aging practitioners specializing in nutritional supplements and hormone-replacement, a practice that may lead to harmful side-effects.

AAA proteases use the energy from ATP hydrolysis to translocate a protein inside the proteasome for degradation. Cdc48p/p97 functions as a hexameric AAA+ ATPase that provides the mechanical force necessary for substrate dislocation. Its activity is tightly regulated by ATP binding and hydrolysis, which induce conformational changes required for protein unfolding and extraction. The HbYX motif plays a crucial role in regulating this process by mediating interactions between Cdc48p/p97 and downstream effectors such as the 20S proteasome or specific cofactors (e.g., Ufd1/Npl4). This interaction facilitates substrate transfer from Cdc48p/p97 to the proteasome, ensuring efficient protein degradation. Given its pivotal role in protein homeostasis, Cdc48p/p97 has been implicated in a wide range of cellular processes beyond ERAD, including autophagy, mitochondrial quality control, and DNA repair. The dysregulation of its function, particularly through mutations affecting the ATPase domain or HbYX-mediated interactions, has been linked to neurodegenerative diseases and cancer.

Camurus AB (publ) is a Swedish research-based pharmaceutical and biotechnology company specialising in the commercialization of medicines for treating serious and chronic diseases. Established in 1991 and based in the southern university city of Lund, in the Medicon Valley region, the company is listed on Nasdaq Stockholm, Mid Cap. Camurus was founded by scientists in biophysical, food, and pharmaceutical chemistry with expertise in lipid phase structures. The company provides nanoscale drug-delivery systems for development of high-value therapeutics.

The amplitude of SHOC2-mediated ERK1/2 signals has been proposed to be regulated by differential regulation of RAF activation at the plasma membrane and internalized endosome compartment as well an alternative model proposing post-translational modifications. SHOC2 ubiquitination mediated by HUWE1 is triggered by growth factor activation of the ERK1/2 pathway and is a prerequisite for the subsequent ubiquitination of the RAF-1 kinase associated with SHOC2. However, the current data has yet to address how these ubiquitin modifications regulate the SHOC2 holophosphatase function to reduce the amplitude of RAF-ERK1/2 signals. It has been shown that activity that results in lipidation (specifically Myristoylation) of SHOC2 can cause Noonan syndrome. SHOC2 has been shown to interact with the catalytic phosphatase subunit PP1C and MRAS as well as canonical RAS isoforms (H/K/NRAS). The ternary complex SHOC2-RAS-PP1C functions to dephosphorylate an inhibitory phosphorylation site ('S259') on RAF family proteins to enable MAPK signaling.

Sources: en.wikipedia.org

Frequently asked questions

Does creatine monohydrate expire?

Dry, sealed creatine monohydrate can remain stable for years, but storage conditions affect its shelf life. Moisture, heat, and repeated opening of containers can reduce quality over time.

Why does creatine turn into creatinine?

Creatine can lose a water molecule and cyclize into creatinine, especially in aqueous solution and at elevated temperatures. This is a chemical degradation process rather than microbial spoilage.

How is creatine monohydrate purity checked?

High-performance liquid chromatography is commonly used to quantify creatine and detect creatinine. Identity can be confirmed with spectroscopy or other instrumental methods.

What is the difference between creatine and creatine monohydrate?

Creatine is the base compound, while creatine monohydrate is a solid crystalline form that contains one water molecule per creatine molecule. Once dissolved, the monohydrate dissociates and releases creatine, which can participate in cellular energy metabolism. The monohydrate is the form most commonly used in research and commercial products.

Network